PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB06G16250.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 712aa    MW: 77963.6 Da    PI: 6.3819
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB06G16250.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.76.5e-211671156
                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
      Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                  r++ +++t+ q+++Le++F+++++p++++r++L+++lgL+ rq+k+WFqNrR+++k
  OB06G16250.1 16 RKRYHRHTPRQIQQLEAMFKECPHPDENQRAQLSRELGLEPRQIKFWFQNRRTQMK 71
                  688899***********************************************998 PP

2START152.73.1e-482124413206
                   HHHHHHHHHHHHHHC-TT-EEEE..........EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EE CS
         START   3 aeeaaqelvkkalaeepgWvkss..........esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                   a +a++el+++a+a++  W+ks+          e +n d++ ++f++ ++       ++e +r+sg+v m ++ l   ++d++ +W e ++    ka
  OB06G16250.1 212 ATRAMDELIRLAQAGDHIWSKSPgggvsggdsrETLNVDTYDSIFSKPGGsyrapsINVEGSRESGLVLMSAVALADVFMDTN-KWMEFFPsivsKA 307
                   6789***********************999999999999999999887779****99****************9999999999.************* PP

                   EEEEEECTT.....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-E CS
         START  80 etlevissg.....galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehv 170
                    t++v+ +g     + l lm+ el  ++p+vp R++ fvRy+rq ++g w+i+dvSvd +++    ++  R+++lpSg+li +++ng+skvtwveh+
  OB06G16250.1 308 HTIDVLVNGmggrsESLILMYEELHIMTPAVPtREVSFVRYCRQIEQGLWAIADVSVDLQRDAHFGAPPPRSRRLPSGCLIADMANGYSKVTWVEHM 404
                   **************************************************************98899****************************** PP

                   E--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
         START 171 dlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                   +++++ p   l+r lv sg+a+ga +w+a+lqr ce+
  OB06G16250.1 405 EVEEKNPiNVLYRDLVLSGAAFGAHRWLAALQRACER 441
                   *******999*************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.88E-20976IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-221078IPR009057Homeodomain-like
PROSITE profilePS5007118.2041373IPR001356Homeobox domain
SMARTSM003894.8E-201477IPR001356Homeobox domain
CDDcd000865.62E-201574No hitNo description
PfamPF000461.8E-181671IPR001356Homeobox domain
PROSITE patternPS0002704871IPR017970Homeobox, conserved site
PROSITE profilePS5084845.358201444IPR002913START domain
SuperFamilySSF559616.73E-31202443No hitNo description
CDDcd088751.23E-110205440No hitNo description
SMARTSM002341.8E-33210441IPR002913START domain
PfamPF018521.3E-40212441IPR002913START domain
SuperFamilySSF559614.4E-19460701No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009828Biological Processplant-type cell wall loosening
GO:0010091Biological Processtrichome branching
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 712 aa     Download sequence    Send to blast
MDFGDEPEGS DSQRRRKRYH RHTPRQIQQL EAMFKECPHP DENQRAQLSR ELGLEPRQIK  60
FWFQNRRTQM KAQHERADNC FLRAENDKIR CENIAIREAL KNVICPTCGG PPVGEDYFDE  120
QKLRMENARL KEELDRVSNL TSKYLGRPFT QLPPATPMSV SSLDLSVGGM SGPGLGGPSL  180
DLDLLSGGSS GIPFQLPAPV SDMERPMMAD MATRAMDELI RLAQAGDHIW SKSPGGGVSG  240
GDSRETLNVD TYDSIFSKPG GSYRAPSINV EGSRESGLVL MSAVALADVF MDTNKWMEFF  300
PSIVSKAHTI DVLVNGMGGR SESLILMYEE LHIMTPAVPT REVSFVRYCR QIEQGLWAIA  360
DVSVDLQRDA HFGAPPPRSR RLPSGCLIAD MANGYSKVTW VEHMEVEEKN PINVLYRDLV  420
LSGAAFGAHR WLAALQRACE RYASLVALGV PHHIAGGAPT PEGKRSMMKL SQRMVNSFCS  480
SLGASQMHQW TTLSGSNEVS VRVTMHRSTD PGQPNGVVLS AATSIWLPVP CDHVFAFVRD  540
ENTRSQWDVL SHGNQVQEVS RIPNGSNPGN CISLLRVITL INLLHNGLNA SQNSMLILQE  600
SCTDASGSLV VYSPIDIPAA NVVMSGEDPS SIPLLPSGFT ILPDXXXXXX XXXXXXXXXX  660
VGSVVTVAFQ ILVSSLPSSK LNAESVATVN GLITTTVEQI KAALNCSAHG HP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00232DAPTransfer from AT1G73360Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642098.10.0PREDICTED: homeobox-leucine zipper protein ROC8
SwissprotQ69T580.0ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8
TrEMBLJ3MC810.0J3MC81_ORYBR; Uncharacterized protein
STRINGOB06G16250.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29123770
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11